PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr003867.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 680aa    MW: 77380.6 Da    PI: 5.2352
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr003867.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS355.39.5e-1093106773374
         GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                  +lL+ cA+ v+s d+++a++ L++++ ++sp+gd +qRla+y++++L+ rl   v++ + +lp+se s    ++ l+a++++  ++P+ k+s++ aNq
  Pbr003867.1 310 TLLTICAQSVASYDKRKANEQLKQIRLNSSPYGDDTQRLAHYVANGLELRLGADVPSNA-SLPSSEMS---AADILKAYQTYITACPFQKMSNIYANQ 403
                  68999***********************************************9666554.45555555...9************************** PP

         GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  +Il+ +e+++r+HiiDf++ +G QWp+L+q L++R++gpp+lRiTgv+ p++g   +e++e+tg+rLa+++++++vpf++nv +a+++e+++ e++++
  Pbr003867.1 404 TILKQAEKATRLHIIDFGVLYGYQWPSLIQDLSKRNGGPPMLRITGVEFPQPGfrPSERVEQTGRRLANYCKRFNVPFKYNV-IATNWETIRSEDIKI 500
                  ****************************************************9****************************9.7************** PP

         GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                  +++E ++Vn+ ++l++l d++v+    rd+vLkl++++sP+++++   + ++n++ F  rf eal ++s+lf+++e+++pre+ +r  +E+e++gr++
  Pbr003867.1 501 DRDELTVVNCLYRLKNLQDDTVTDCP-RDTVLKLIRRISPDLFIHGVVNGSYNAPFFDIRFREALFHFSSLFNMFEETVPREDPQRLLYEQEVFGRDV 597
                  *****************988887777.*********************************************************************** PP

         GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                   nv+aceg +r+er et+++W+ r ++aGF++vp ++++ k++++++++ + + ++++e+  ++++gWk+r   ++S W+
  Pbr003867.1 598 INVIACEGPRRVERPETYKQWQTRNMRAGFRQVPSDQEILKEVRSMVKRDYHKDFSIDEDGMWMLQGWKGRIFHAISYWK 677
                  *************************************************99888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.719282657IPR005202Transcription factor GRAS
PfamPF035143.3E-106310677IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 680 aa     Download sequence    Send to blast
MDTLEDELPS PMNKSVIEQV DDSNANPVHE FGASHDFTDH NFFPVNSDPS DNLPSLPGVS  60
TEVNFPERSE ASNAILKYIS EMLMEEEEYL VNKPCMLQEC LALQAAEKSL HDVLVQDQNP  120
SSSDPLNFIH RNVEAPNEGS NHSSTGSIAA GNRVGLDWGS VQDVFESSRA QIPNPLVLSG  180
EGEITHLKHN SSSVVELREQ QGNDVSFNLD KDGSDSSNGS RSKRSHQRED EDSLDDWRRN  240
KDPAVYADEF ELPQLFDEVL LCQGEKQESN SCSPKESEKL QLNRKSKGSK GKKTRKKKLD  300
DNAGMVDLWT LLTICAQSVA SYDKRKANEQ LKQIRLNSSP YGDDTQRLAH YVANGLELRL  360
GADVPSNASL PSSEMSAADI LKAYQTYITA CPFQKMSNIY ANQTILKQAE KATRLHIIDF  420
GVLYGYQWPS LIQDLSKRNG GPPMLRITGV EFPQPGFRPS ERVEQTGRRL ANYCKRFNVP  480
FKYNVIATNW ETIRSEDIKI DRDELTVVNC LYRLKNLQDD TVTDCPRDTV LKLIRRISPD  540
LFIHGVVNGS YNAPFFDIRF REALFHFSSL FNMFEETVPR EDPQRLLYEQ EVFGRDVINV  600
IACEGPRRVE RPETYKQWQT RNMRAGFRQV PSDQEILKEV RSMVKRDYHK DFSIDEDGMW  660
MLQGWKGRIF HAISYWKPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-453126778375GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1283298RKSKGSKGKKTRKKKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009364373.10.0PREDICTED: scarecrow-like protein 11
TrEMBLM5W3910.0M5W391_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s24890.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-166GRAS family protein